This package contains the proteins
dataset and some developmental
utility functions related to proteomic and protein analyses. The dataset
accompanies a workshop-style class that provides an introduction to the
emerging field of Data Science in R, including data analysis and
visualization, with a particular focus on its utility for biological
insight.
You cannot yet install the released version of tidybiology from CRAN with:
install.packages("proteins")
So in the meantime, use the development version from GitHub with:
# install.packages("devtools")
devtools::install_github("hirscheylab/proteins")
This is how to take a glimpse
into the proteins dataset:
library(proteins)
glimpse(proteins)
#> Observations: 20,430
#> Variables: 8
#> $ uniprot_id <chr> "P04217", "Q9NQ94", "P01023", "A8K2U0", "U3KPV4…
#> $ gene_name <chr> "A1BG", "A1CF", "A2M", "A2ML1", "A3GALT2", "A4G…
#> $ gene_name_alt <chr> NA, "ACF ASP", "CPAMD5 FWP007", "CPAMD9", "A3GA…
#> $ protein_name <chr> "Alpha-1B-glycoprotein ", "APOBEC1 complementat…
#> $ protein_name_alt <chr> "Alpha-1-B glycoprotein)", "APOBEC1-stimulating…
#> $ sequence <chr> "MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVT…
#> $ length <dbl> 495, 594, 1474, 1454, 340, 353, 340, 546, 672, …
#> $ mass <dbl> 54254, 65202, 163291, 161107, 38754, 40499, 394…
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.