#' Run PureseqTM directy on a protein sequence
#'
#' Will \link{stop} if the protein sequence is shorter than three
#' amino acids.
#' @param protein_sequence a protein sequence, with
#' the amino acids as capitals, for
#' example `MEILCEDNTSLSSIPNSL`
#' @inheritParams default_params_doc
#' @return a topology as a string of zeroes and ones, where a one denotes
#' that the corresponding amino acid is located within the membrane.
#' @examples
#' if (is_pureseqtm_installed()) {
#' protein_sequence <- paste0(
#' "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
#' "SLAIADMLLGFLVMPVSMLTILYGYRWP"
#' )
#' predict_topology_from_sequence(protein_sequence)
#' }
#' @author Richèl J.C. Bilderbeek
#' @export
predict_topology_from_sequence <- function(
protein_sequence,
folder_name = get_default_pureseqtm_folder(),
temp_fasta_filename = tempfile(fileext = ".fasta")
) {
pureseqtmr::check_protein_sequence(protein_sequence)
pureseqtmr::predict_topologies_from_sequences(
protein_sequences = protein_sequence,
folder_name = folder_name,
temp_fasta_filename = temp_fasta_filename
)
}
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.