tests/testthat/test-is_tmh.R
In richelbilderbeek/pureseqtmr: Predict Transmembrane Protein Topology
test_that("use", {
if (!is_pureseqtm_installed()) return()
expect_true(is_tmh("QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM"))
expect_false(is_tmh("VVIILTIRGNILVIMAVSLE"))
})
richelbilderbeek/pureseqtmr documentation built on April 16, 2023, 1:19 p.m.
R Package Documentation
Browse R Packages
We want your feedback!
Note that we can't provide technical support on individual packages. You should contact the package authors for that.
test_that("use", {
if (!is_pureseqtm_installed()) return()
expect_true(is_tmh("QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM"))
expect_false(is_tmh("VVIILTIRGNILVIMAVSLE"))
})
R Package Documentation
Browse R Packages
We want your feedback!
Note that we can't provide technical support on individual packages. You should contact the package authors for that.
Embedding an R snippet on your website
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.