Description Usage Arguments Value Examples
This function generates a graphic output of the frequency of nsSNPs for each sequential group of 50 aminoacids at the CYP isoform provided. baseSeqs.rda or a custom sequence of wild isoforms must be loaded.
1 |
CYP |
CYP isoform to be analyzed, string |
seq |
Aminoacid sequence (one-letter code) for the CYP isoform to be analyzed (list of strings) |
Visualization of the frequency of nsSNPs for each protein region Also return the SNPs positions for each region
1 2 3 4 5 6 7 8 9 10 11 12 13 14 | ## Not run:
load(file = "./data/baseSeqs.rda")
snpDist("CYP1A2",
paste("AALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN",
"LALALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG",
"TFSTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM",
"GHFGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP",
"PNPALPNPALQRFKAFNQRFLWFLQKTVQEHYQKNSKNSVRDITGALFKHSKKGPRASGN",
"PQPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS",
"PQPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL",
"EEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE",
"SSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN", sep=""))
## End(Not run)
|
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.