#' Run TMHMM directy on a protein sequence
#' @inheritParams default_params_doc
#' @return a topology sequence,
#' for example \code{"iiiimmmmmoooo"}
#' @seealso Use \link{mock_predict_topology_from_sequence} to
#' do a mock prediction
#' @examples
#' if (is_tmhmm_installed()) {
#' protein_sequence <- paste0(
#' "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
#' "SLAIADMLLGFLVMPVSMLTILYGYRWP"
#' )
#' predict_topology_from_sequence(protein_sequence)
#' }
#' @author Richèl J.C. Bilderbeek
#' @export
predict_topology_from_sequence <- function(
protein_sequence,
folder_name = get_default_tmhmm_folder(),
temp_fasta_filename = tempfile(fileext = ".fasta"),
temp_topology_filename = tempfile(fileext = ".topo")
) {
tmhmm::predict_topologies_from_sequences(
protein_sequences = protein_sequence,
folder_name = folder_name,
temp_fasta_filename = temp_fasta_filename,
temp_topology_filename = temp_topology_filename
)
}
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.