getResultsFromServer: Get results from server MUFOLD server
In mpyatkov/aatoss: What the Package Does (One Line, Title Case)

Description Usage Arguments Value Examples

View source: R/aatoss.R

Get results from server MUFOLD server

1	getResultsFromServer(send_object)

send_object

object which was obtained by function 'sendToServer'

data.frame with prediction of secondary structure

email = "test11@test.com"
testseq <- data.frame(target = c("fasta_seq1", "fasta_seq2"),
                      fasta  = c("RDPHPAPPRTSQEPHQNPHGVIPSESKPFVASKPKPHT",
                                 "PSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRLSSE"),
                      stringsAsFactors=FALSE)

# send sequences to server

sequences <- sendToServer(testseq, email)

# wait a couple of minutes, 1 sequence ~ 1-2 minutes of calculation

# retrive results from server ( only finished sequences )

structures <- getResultsFromServer(sequences)

# or you can obtain all finished sequences which associated with this email

all.structures <- getAllResultsFromServer(email)