sendToServer: Title Send sequences to server
In mpyatkov/aatoss: What the Package Does (One Line, Title Case)

Description Usage Arguments Value Examples

Title Send sequences to server

1	sendToServer(df_sequences, email)

`df_sequences`	data.frame with sequences (columns target and fasta required)
`email`	at the moment any email-like identifier, it is not checked

object which you can use as input to retrieve results from server

email = "test11@test.com"
testseq <- data.frame(target = c("fasta_seq1", "fasta_seq2"),
                      fasta  = c("RDPHPAPPRTSQEPHQNPHGVIPSESKPFVASKPKPHT",
                                 "PSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRLSSE"),
                      stringsAsFactors=FALSE)

# send sequences to server

sequences <- sendToServer(testseq, email)

# wait a couple of minutes, 1 sequence ~ 1-2 minutes of calculation

# retrive results from server ( only finished sequences )

structures <- getResultsFromServer(sequences)

# or you can obtain all finished sequences which associated with this email

all.structures <- getAllResultsFromServer(email)