#' Predict the number of n-mers and the number of n-mers
#' that overlap with at least one amino acid with a TMH
#' for one peptide.
#' @inheritParams default_params_doc
#' @return a tibble with
#' \enumerate{
#' \item n_spots number of spots for the n-mer
#' \item n_spots_tmh number of spots that have one
#' amino acid overlapping with a TMH
#' }
#' @author Richèl J.C. Bilderbeek
#' @examples
#' library(pureseqtmr)
#'
#' if (is_pureseqtm_installed()) {
#'
#' protein_sequence <- paste0(
#' "MYSFVSEETGTLIVNSVLLFLAFVVFLLV",
#' "TLAILTALRLCAYCCNIVNVSLVKPSFYVYSRV"
#' )
#'
#' predict_n_coincidence_tmh_peptide(
#' protein_sequence = protein_sequence,
#' peptide_length = 9,
#' ic50_prediction_tool = "EpitopePrediction"
#' )
#' }
#' @export
predict_n_coincidence_tmh_peptide <- function(# nolint indeed a long function name
protein_sequence,
peptide_length,
verbose = FALSE,
ic50_prediction_tool
) {
bbbq::predict_counts(
protein_sequence = protein_sequence,
peptide_length = peptide_length,
haplotype = get_mhc1_haplotypes()[1],
percentile = 0.0,
verbose = verbose,
ic50_prediction_tool = ic50_prediction_tool
)
}
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.