Description Usage Arguments Details Value Author(s) References See Also Examples
Cleave an amino acid sequence (a protein or peptide) according to enzyme specific rules and calculate the precursor ion m/z values.
| 1 2 | 
| sequence | a character string representing the amino acid sequence to be cleaved by the enzyme. | 
| enzyme | a character string specifying the rules for cleavage.  Options are  | 
| missed | the maximum number of missed cleavages. Must be an integer of 0 (default) or greater. An error will result if the specified number of missed cleavages is greater than the maximum possible number of missed cleavages. | 
| IAA | logical.  | 
| N15 | logical indicating if the nitrogen-15 isotope should be used in place of the default nitrogen-14 isotope. | 
| custom | a list specifying user defined residues as  | 
The amino acid residues must be specified by one letter codes. The predefined residues are:
| A = alanine | L = leucine | 
| R = arginine | K = lysine | 
| N = asparagine | M = methionine | 
| D = aspartic acid | F = phenylalanine | 
| C = cysteine | P = proline | 
| E = glutamic acid | S = serine | 
| Q = glutamine | T = threonine | 
| G = glycine | W = tryptophan | 
| H = histidine | Y = tyrosine | 
| I = isoleucine | V = valine | 
If "trypsin" is specified, the sequence is cleaved on the c-terminal side of K and R residues, except if K or R is followed by P.  If "trypsin.strict" is specified, the sequence is cleaved on the c-terminal side of K and R residues. If "pepsin" is specified, the sequence is cleaved on the c-terminal side of F, L, W, Y, A, E, and Q residues.  This rule is specific to pepsin at pH > 2, as used in hydrogen-deuterium exchange experiments.
When "trypsin" is specified, KP and RP are not considered missed cleavages when missed is > 0.
The argument IAA specifies treatment of the protein with iodoacetamide.  This treatment produces iodoacetylated cysteine residues (elemental formula C5H8N2O2S).
If TRUE, the argument N15 specifies 100% nitrogen-15 incorporation.  It is intended for proteins grown with a nitrogen-15 labeled food source.  (Although the experiment itself may grow a protein with less than 100% nitrogen-15 incorporation).  Setting N15 = TRUE does not modify the mass of a custom residue, or the mass of the nitrogen(s) added if IAA = TRUE.
If a custom residue code is identical to a predefined residue code, the custom residue mass will be used in place of the predefined mass.
The error message “object "mass" not found” indicates the input sequence contains an undefined residue(s).
A data frame with the following column names.
| peptide | resulting peptides. | 
| start | beginning residue positions in the the original sequence. | 
| end | ending residue positions in the the original sequence. | 
| mc | number of missed cleavages. | 
| mz1 | monoisotopic m/z values for the [M + H]1+ ions (where M is the precursor mass). | 
| mz2 | monoisotopic m/z values for the [M + 2H]2+ ions. | 
| mz3 | monoisotopic m/z values for the [M + 3H]3+ ions. | 
Nathan G. Dodder
The relative atomic masses of the isotopes are from the NIST Physical Reference Data Website http://physics.nist.gov/PhysRefData/Compositions/. The molar mass of a proton (H+) is from the NIST CODATA Website http://physics.nist.gov/cuu/Constants/index.html.
MonoisotopicMass, FragmentPeptide
| 1 2 3 4 5 6 7 8 9 10 11 12 13 14 | ## digest human serum albumin with 0 and 1 missed cleavages
Digest(example.sequence, missed = 1)
## digest human serum albumin with a phosphoserine at position 58
## and all methionines oxidized
modifiedHsaSequence <- strsplit(example.sequence, split = "")[[1]]
modifiedHsaSequence[58] <- "s"   # insert code for phosphoserine  
modifiedHsaSequence <- paste(modifiedHsaSequence, collapse = "")
Digest(modifiedHsaSequence, custom = list(code = c("s","M"), 
       mass = c(MonoisotopicMass(list(C=3, H=6, N=1, O=5, P=1)),
                MonoisotopicMass(list(C=5, H=9, N=1, O=2, S=1)))))
                
## digest human serum albumin with strict rules
Digest(example.sequence, enzyme = "trypsin.strict")
 | 
Loading required package: grid
                                  peptide start stop mc      mz1      mz2
1                                    DAHK     1    4  0  470.236  235.622
2                                  SEVAHR     5   10  0  698.358  349.683
3                                      FK    11   12  0  294.181  147.594
4                                DLGEENFK    13   20  0  951.442  476.225
5                   ALVLIAFAQYLQQCPFEDHVK    21   41  0 2490.285 1245.646
6                              LVNEVTEFAK    42   51  0 1149.615  575.311
7                           TCVADESAENCDK    52   64  0 1498.578  749.793
8                               SLHTLFGDK    65   73  0 1017.536  509.272
9                                LCTVATLR    74   81  0  933.519  467.263
10                           ETYGEMADCCAK    82   93  0 1434.533  717.770
11                                  QEPER    94   98  0  658.315  329.661
12                               NECFLQHK    99  106  0 1075.499  538.253
13                               DDNPNLPR   107  114  0  940.448  470.728
14                 LVRPEVDVMCTAFHDNEETFLK   115  136  0 2650.264 1325.636
15                                      K   137  137  0  147.113   74.060
16                                YLYEIAR   138  144  0  927.493  464.250
17                                      R   145  145  0  175.119   88.063
18                         HPYFYAPELLFFAK   146  159  0 1742.894  871.951
19                                      R   160  160  0  175.119   88.063
20                                     YK   161  162  0  310.176  155.592
21                           AAFTECCQAADK   163  174  0 1371.567  686.287
22                                AACLLPK   175  181  0  772.439  386.723
23                                  LDELR   182  186  0  645.357  323.182
24                                   DEGK   187  190  0  448.204  224.606
25                                  ASSAK   191  195  0  463.251  232.129
26                                     QR   196  197  0  303.178  152.092
27                                     LK   198  199  0  260.197  130.602
28                                 CASLQK   200  205  0  706.355  353.681
29                                   FGER   206  209  0  508.251  254.629
30                                    AFK   210  212  0  365.218  183.113
31                                 AWAVAR   213  218  0  673.378  337.193
32                                   LSQR   219  222  0  503.294  252.150
33                                    FPK   223  225  0  391.234  196.121
34                               AEFAEVSK   226  233  0  880.441  440.724
35                                LVTDLTK   234  240  0  789.472  395.239
36                      VHTECCHGDLLECADDR   241  257  0 2086.838 1043.922
37                                  ADLAK   258  262  0  517.298  259.153
38                           YICENQDSISSK   263  274  0 1443.642  722.325
39                                     LK   275  276  0  260.197  130.602
40                             ECCEKPLLEK   277  286  0 1305.618  653.313
41            SHCIAEVENDEMPADLPSLAADFVESK   287  313  0 2974.344 1487.676
42                                   DVCK   314  317  0  521.239  261.123
43                                 NYAEAK   318  323  0  695.336  348.172
44                          DVFLGMFLYEYAR   324  336  0 1623.788  812.397
45                                      R   337  337  0  175.119   88.063
46                            HPDYSVVLLLR   338  348  0 1311.742  656.375
47                                    LAK   349  351  0  331.234  166.121
48                               TYETTLEK   352  359  0  984.488  492.748
49                          CCAAADPHECYAK   360  372  0 1552.598  776.803
50                      VFDEFKPLVEEPQNLIK   373  389  0 2045.095 1023.051
51                          QNCELFEQLGEYK   390  402  0 1657.753  829.380
52                               FQNALLVR   403  410  0  960.563  480.785
53                                    YTK   411  413  0  411.224  206.116
54                                      K   414  414  0  147.113   74.060
55                         VPQVSTPTLVEVSR   415  428  0 1511.843  756.425
56                                   NLGK   429  432  0  431.261  216.134
57                                   VGSK   433  436  0  390.235  195.621
58                                    CCK   437  439  0  467.174  234.091
59                                  HPEAK   440  444  0  581.304  291.156
60                                      R   445  445  0  175.119   88.063
61                  MPCAEDYLSVVLNQLCVLHEK   446  466  0 2518.214 1259.611
62                                 TPVSDR   467  472  0  674.347  337.677
63                                    VTK   473  475  0  347.229  174.118
64                              CCTESLVNR   476  484  0 1138.498  569.753
65                       RPCFSALEVDETYVPK   485  500  0 1910.932  955.969
66                    EFNAETFTFHADICTLSEK   501  519  0 2260.023 1130.515
67                                     ER   520  521  0  304.162  152.584
68                                    QIK   522  524  0  388.255  194.631
69                                      K   525  525  0  147.113   74.060
70                              QTALVELVK   526  534  0 1000.604  500.805
71                                   HKPK   535  538  0  509.319  255.163
72                                    ATK   539  541  0  319.198  160.102
73                                   EQLK   542  545  0  517.298  259.153
74                           AVMDDFAAFVEK   546  557  0 1342.635  671.821
75                                    CCK   558  560  0  467.174  234.091
76                                   ADDK   561  564  0  448.204  224.606
77                              ETCFAEEGK   565  573  0 1070.446  535.727
78                                      K   574  574  0  147.113   74.060
79                            LVAASQAALGL   575  585  0 1013.599  507.303
80                             DAHKSEVAHR     1   10  1 1149.576  575.292
81                               SEVAHRFK     5   12  1  973.521  487.264
82                             FKDLGEENFK    11   20  1 1226.605  613.806
83          DLGEENFKALVLIAFAQYLQQCPFEDHVK    13   41  1 3422.709 1711.858
84        ALVLIAFAQYLQQCPFEDHVKLVNEVTEFAK    21   51  1 3620.882 1810.945
85                LVNEVTEFAKTCVADESAENCDK    42   64  1 2629.176 1315.091
86                 TCVADESAENCDKSLHTLFGDK    52   73  1 2497.097 1249.052
87                      SLHTLFGDKLCTVATLR    65   81  1 1932.037  966.522
88                   LCTVATLRETYGEMADCCAK    74   93  1 2349.034 1175.021
89                      ETYGEMADCCAKQEPER    82   98  1 2073.831 1037.419
90                          QEPERNECFLQHK    94  106  1 1714.797  857.902
91                       NECFLQHKDDNPNLPR    99  114  1 1996.929  998.968
92         DDNPNLPRLVRPEVDVMCTAFHDNEETFLK   107  136  1 3571.694 1786.351
93                LVRPEVDVMCTAFHDNEETFLKK   115  137  1 2778.359 1389.683
94                               KYLYEIAR   137  144  1 1055.588  528.298
95                               YLYEIARR   138  145  1 1083.595  542.301
96                        RHPYFYAPELLFFAK   145  159  1 1898.995  950.001
97                        HPYFYAPELLFFAKR   146  160  1 1898.995  950.001
98                                    RYK   160  162  1  466.277  233.642
99                         YKAAFTECCQAADK   161  174  1 1662.725  831.866
100                   AAFTECCQAADKAACLLPK   163  181  1 2124.987 1062.997
101                          AACLLPKLDELR   175  186  1 1398.777  699.892
102                             LDELRDEGK   182  190  1 1074.543  537.775
103                             DEGKASSAK   187  195  1  892.437  446.722
104                               ASSAKQR   191  197  1  747.411  374.209
105                                  QRLK   196  199  1  544.357  272.682
106                              LKCASLQK   198  205  1  947.534  474.271
107                            CASLQKFGER   200  209  1 1195.589  598.298
108                               FGERAFK   206  212  1  854.452  427.730
109                             AFKAWAVAR   210  218  1 1019.579  510.293
110                            AWAVARLSQR   213  222  1 1157.654  579.331
111                               LSQRFPK   219  225  1  875.510  438.259
112                           FPKAEFAEVSK   223  233  1 1252.657  626.832
113                       AEFAEVSKLVTDLTK   226  240  1 1650.895  825.951
114              LVTDLTKVHTECCHGDLLECADDR   234  257  1 2857.291 1429.149
115                VHTECCHGDLLECADDRADLAK   241  262  1 2585.118 1293.063
116                     ADLAKYICENQDSISSK   258  274  1 1941.922  971.465
117                        YICENQDSISSKLK   263  276  1 1684.821  842.914
118                          LKECCEKPLLEK   275  286  1 1546.797  773.902
119 ECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESK   277  313  1 4260.944 2130.976
120       SHCIAEVENDEMPADLPSLAADFVESKDVCK   287  317  1 3476.565 1738.786
121                            DVCKNYAEAK   314  323  1 1197.557  599.282
122                   NYAEAKDVFLGMFLYEYAR   318  336  1 2300.106 1150.556
123                        DVFLGMFLYEYARR   324  337  1 1779.889  890.448
124                          RHPDYSVVLLLR   337  348  1 1467.843  734.425
125                        HPDYSVVLLLRLAK   338  351  1 1623.958  812.483
126                           LAKTYETTLEK   349  359  1 1296.705  648.856
127                 TYETTLEKCCAAADPHECYAK   352  372  1 2518.068 1259.538
128        CCAAADPHECYAKVFDEFKPLVEEPQNLIK   360  389  1 3578.675 1789.841
129        VFDEFKPLVEEPQNLIKQNCELFEQLGEYK   373  402  1 3683.830 1842.419
130                 QNCELFEQLGEYKFQNALLVR   390  410  1 2599.297 1300.152
131                           FQNALLVRYTK   403  413  1 1352.768  676.888
132                                  YTKK   411  414  1  539.319  270.163
133                       KVPQVSTPTLVEVSR   414  428  1 1639.938  820.473
134                    VPQVSTPTLVEVSRNLGK   415  432  1 1924.086  962.547
135                              NLGKVGSK   429  436  1  802.478  401.743
136                               VGSKCCK   433  439  1  838.391  419.699
137                              CCKHPEAK   437  444  1 1029.460  515.234
138                                HPEAKR   440  445  1  737.405  369.206
139                RMPCAEDYLSVVLNQLCVLHEK   445  466  1 2674.315 1337.661
140           MPCAEDYLSVVLNQLCVLHEKTPVSDR   446  472  1 3173.543 1587.275
141                             TPVSDRVTK   467  475  1 1002.558  501.783
142                          VTKCCTESLVNR   473  484  1 1466.709  733.858
143             CCTESLVNRRPCFSALEVDETYVPK   476  500  1 3030.412 1515.710
144   RPCFSALEVDETYVPKEFNAETFTFHADICTLSEK   485  519  1 4151.937 2076.472
145                 EFNAETFTFHADICTLSEKER   501  521  1 2545.166 1273.087
146                                 ERQIK   520  524  1  673.399  337.203
147                                  QIKK   522  525  1  516.350  258.679
148                            KQTALVELVK   525  534  1 1128.699  564.853
149                         QTALVELVKHKPK   526  538  1 1490.905  745.956
150                               HKPKATK   535  541  1  809.499  405.253
151                               ATKEQLK   539  545  1  817.478  409.243
152                      EQLKAVMDDFAAFVEK   542  557  1 1840.915  920.961
153                       AVMDDFAAFVEKCCK   546  560  1 1790.791  895.899
154                               CCKADDK   558  564  1  896.360  448.684
155                         ADDKETCFAEEGK   561  573  1 1499.632  750.320
156                            ETCFAEEGKK   565  574  1 1198.541  599.774
157                          KLVAASQAALGL   574  585  1 1141.694  571.351
         mz3
1    157.417
2    233.458
3     98.732
4    317.819
5    830.767
6    383.877
7    500.198
8    339.850
9    311.844
10   478.849
11   220.110
12   359.171
13   314.154
14   884.093
15    49.709
16   309.836
17    59.045
18   581.636
19    59.045
20   104.064
21   457.860
22   258.151
23   215.790
24   150.073
25   155.089
26   101.731
27    87.404
28   236.123
29   170.089
30   122.411
31   225.131
32   168.436
33   131.083
34   294.152
35   263.829
36   696.284
37   173.104
38   481.886
39    87.404
40   435.877
41   992.120
42   174.418
43   232.450
44   541.934
45    59.045
46   437.919
47   111.083
48   328.834
49   518.204
50   682.370
51   553.256
52   320.859
53   137.746
54    49.709
55   504.619
56   144.425
57   130.750
58   156.396
59   194.440
60    59.045
61   840.076
62   225.454
63   116.414
64   380.171
65   637.649
66   754.012
67   102.059
68   130.090
69    49.709
70   334.206
71   170.445
72   107.071
73   173.104
74   448.216
75   156.396
76   150.073
77   357.487
78    49.709
79   338.538
80   383.863
81   325.179
82   409.540
83  1141.574
84  1207.632
85   877.063
86   833.037
87   644.684
88   783.683
89   691.949
90   572.270
91   666.315
92  1191.236
93   926.791
94   352.534
95   361.870
96   633.670
97   633.670
98   156.097
99   554.913
100  709.001
101  466.931
102  358.852
103  298.151
104  249.808
105  182.124
106  316.516
107  399.201
108  285.489
109  340.531
110  386.556
111  292.508
112  418.224
113  550.970
114  953.102
115  862.377
116  647.979
117  562.279
118  516.270
119 1420.986
120 1159.527
121  399.857
122  767.373
123  593.968
124  489.953
125  541.991
126  432.906
127  840.028
128 1193.563
129 1228.615
130  867.104
131  451.594
132  180.444
133  547.317
134  642.034
135  268.164
136  280.135
137  343.825
138  246.473
139  892.110
140 1058.519
141  334.857
142  489.575
143 1010.809
144 1384.650
145  849.060
146  225.138
147  172.788
148  376.904
149  497.640
150  270.505
151  273.164
152  614.310
153  597.602
154  299.458
155  500.549
156  400.185
157  381.236
                       peptide start stop mc      mz1      mz2     mz3
1                         DAHK     1    4  0  470.236  235.622 157.417
2                       SEVAHR     5   10  0  698.358  349.683 233.458
3                           FK    11   12  0  294.181  147.594  98.732
4                     DLGEENFK    13   20  0  951.442  476.225 317.819
5        ALVLIAFAQYLQQCPFEDHVK    21   41  0 2490.285 1245.646 830.767
6                   LVNEVTEFAK    42   51  0 1149.615  575.311 383.877
7                TCVADEsAENCDK    52   64  0 1578.545  789.776 526.853
8                    SLHTLFGDK    65   73  0 1017.536  509.272 339.850
9                     LCTVATLR    74   81  0  933.519  467.263 311.844
10                ETYGEMADCCAK    82   93  0 1450.528  725.768 484.181
11                       QEPER    94   98  0  658.315  329.661 220.110
12                    NECFLQHK    99  106  0 1075.499  538.253 359.171
13                    DDNPNLPR   107  114  0  940.448  470.728 314.154
14      LVRPEVDVMCTAFHDNEETFLK   115  136  0 2666.259 1333.633 889.424
15                           K   137  137  0  147.113   74.060  49.709
16                     YLYEIAR   138  144  0  927.493  464.250 309.836
17                           R   145  145  0  175.119   88.063  59.045
18              HPYFYAPELLFFAK   146  159  0 1742.894  871.951 581.636
19                           R   160  160  0  175.119   88.063  59.045
20                          YK   161  162  0  310.176  155.592 104.064
21                AAFTECCQAADK   163  174  0 1371.567  686.287 457.860
22                     AACLLPK   175  181  0  772.439  386.723 258.151
23                       LDELR   182  186  0  645.357  323.182 215.790
24                        DEGK   187  190  0  448.204  224.606 150.073
25                       ASSAK   191  195  0  463.251  232.129 155.089
26                          QR   196  197  0  303.178  152.092 101.731
27                          LK   198  199  0  260.197  130.602  87.404
28                      CASLQK   200  205  0  706.355  353.681 236.123
29                        FGER   206  209  0  508.251  254.629 170.089
30                         AFK   210  212  0  365.218  183.113 122.411
31                      AWAVAR   213  218  0  673.378  337.193 225.131
32                        LSQR   219  222  0  503.294  252.150 168.436
33                         FPK   223  225  0  391.234  196.121 131.083
34                    AEFAEVSK   226  233  0  880.441  440.724 294.152
35                     LVTDLTK   234  240  0  789.472  395.239 263.829
36           VHTECCHGDLLECADDR   241  257  0 2086.838 1043.922 696.284
37                       ADLAK   258  262  0  517.298  259.153 173.104
38                YICENQDSISSK   263  274  0 1443.642  722.325 481.886
39                          LK   275  276  0  260.197  130.602  87.404
40                  ECCEKPLLEK   277  286  0 1305.618  653.313 435.877
41 SHCIAEVENDEMPADLPSLAADFVESK   287  313  0 2990.339 1495.673 997.451
42                        DVCK   314  317  0  521.239  261.123 174.418
43                      NYAEAK   318  323  0  695.336  348.172 232.450
44               DVFLGMFLYEYAR   324  336  0 1639.782  820.395 547.266
45                           R   337  337  0  175.119   88.063  59.045
46                 HPDYSVVLLLR   338  348  0 1311.742  656.375 437.919
47                         LAK   349  351  0  331.234  166.121 111.083
48                    TYETTLEK   352  359  0  984.488  492.748 328.834
49               CCAAADPHECYAK   360  372  0 1552.598  776.803 518.204
50           VFDEFKPLVEEPQNLIK   373  389  0 2045.095 1023.051 682.370
51               QNCELFEQLGEYK   390  402  0 1657.753  829.380 553.256
52                    FQNALLVR   403  410  0  960.563  480.785 320.859
53                         YTK   411  413  0  411.224  206.116 137.746
54                           K   414  414  0  147.113   74.060  49.709
55              VPQVSTPTLVEVSR   415  428  0 1511.843  756.425 504.619
56                        NLGK   429  432  0  431.261  216.134 144.425
57                        VGSK   433  436  0  390.235  195.621 130.750
58                         CCK   437  439  0  467.174  234.091 156.396
59                       HPEAK   440  444  0  581.304  291.156 194.440
60                           R   445  445  0  175.119   88.063  59.045
61       MPCAEDYLSVVLNQLCVLHEK   446  466  0 2534.209 1267.608 845.408
62                      TPVSDR   467  472  0  674.347  337.677 225.454
63                         VTK   473  475  0  347.229  174.118 116.414
64                   CCTESLVNR   476  484  0 1138.498  569.753 380.171
65            RPCFSALEVDETYVPK   485  500  0 1910.932  955.969 637.649
66         EFNAETFTFHADICTLSEK   501  519  0 2260.023 1130.515 754.012
67                          ER   520  521  0  304.162  152.584 102.059
68                         QIK   522  524  0  388.255  194.631 130.090
69                           K   525  525  0  147.113   74.060  49.709
70                   QTALVELVK   526  534  0 1000.604  500.805 334.206
71                        HKPK   535  538  0  509.319  255.163 170.445
72                         ATK   539  541  0  319.198  160.102 107.071
73                        EQLK   542  545  0  517.298  259.153 173.104
74                AVMDDFAAFVEK   546  557  0 1358.630  679.818 453.548
75                         CCK   558  560  0  467.174  234.091 156.396
76                        ADDK   561  564  0  448.204  224.606 150.073
77                   ETCFAEEGK   565  573  0 1070.446  535.727 357.487
78                           K   574  574  0  147.113   74.060  49.709
79                 LVAASQAALGL   575  585  0 1013.599  507.303 338.538
                       peptide start stop mc      mz1      mz2     mz3
1                         DAHK     1    4  0  470.236  235.622 157.417
2                       SEVAHR     5   10  0  698.358  349.683 233.458
3                           FK    11   12  0  294.181  147.594  98.732
4                     DLGEENFK    13   20  0  951.442  476.225 317.819
5        ALVLIAFAQYLQQCPFEDHVK    21   41  0 2490.285 1245.646 830.767
6                   LVNEVTEFAK    42   51  0 1149.615  575.311 383.877
7                TCVADESAENCDK    52   64  0 1498.578  749.793 500.198
8                    SLHTLFGDK    65   73  0 1017.536  509.272 339.850
9                     LCTVATLR    74   81  0  933.519  467.263 311.844
10                ETYGEMADCCAK    82   93  0 1434.533  717.770 478.849
11                       QEPER    94   98  0  658.315  329.661 220.110
12                    NECFLQHK    99  106  0 1075.499  538.253 359.171
13                    DDNPNLPR   107  114  0  940.448  470.728 314.154
14                         LVR   115  117  0  387.271  194.139 129.762
15         PEVDVMCTAFHDNEETFLK   118  136  0 2282.010 1141.509 761.342
16                           K   137  137  0  147.113   74.060  49.709
17                     YLYEIAR   138  144  0  927.493  464.250 309.836
18                           R   145  145  0  175.119   88.063  59.045
19              HPYFYAPELLFFAK   146  159  0 1742.894  871.951 581.636
20                           R   160  160  0  175.119   88.063  59.045
21                          YK   161  162  0  310.176  155.592 104.064
22                AAFTECCQAADK   163  174  0 1371.567  686.287 457.860
23                     AACLLPK   175  181  0  772.439  386.723 258.151
24                       LDELR   182  186  0  645.357  323.182 215.790
25                        DEGK   187  190  0  448.204  224.606 150.073
26                       ASSAK   191  195  0  463.251  232.129 155.089
27                          QR   196  197  0  303.178  152.092 101.731
28                          LK   198  199  0  260.197  130.602  87.404
29                      CASLQK   200  205  0  706.355  353.681 236.123
30                        FGER   206  209  0  508.251  254.629 170.089
31                         AFK   210  212  0  365.218  183.113 122.411
32                      AWAVAR   213  218  0  673.378  337.193 225.131
33                        LSQR   219  222  0  503.294  252.150 168.436
34                         FPK   223  225  0  391.234  196.121 131.083
35                    AEFAEVSK   226  233  0  880.441  440.724 294.152
36                     LVTDLTK   234  240  0  789.472  395.239 263.829
37           VHTECCHGDLLECADDR   241  257  0 2086.838 1043.922 696.284
38                       ADLAK   258  262  0  517.298  259.153 173.104
39                YICENQDSISSK   263  274  0 1443.642  722.325 481.886
40                          LK   275  276  0  260.197  130.602  87.404
41                       ECCEK   277  281  0  725.259  363.133 242.425
42                       PLLEK   282  286  0  599.376  300.192 200.464
43 SHCIAEVENDEMPADLPSLAADFVESK   287  313  0 2974.344 1487.676 992.120
44                        DVCK   314  317  0  521.239  261.123 174.418
45                      NYAEAK   318  323  0  695.336  348.172 232.450
46               DVFLGMFLYEYAR   324  336  0 1623.788  812.397 541.934
47                           R   337  337  0  175.119   88.063  59.045
48                 HPDYSVVLLLR   338  348  0 1311.742  656.375 437.919
49                         LAK   349  351  0  331.234  166.121 111.083
50                    TYETTLEK   352  359  0  984.488  492.748 328.834
51               CCAAADPHECYAK   360  372  0 1552.598  776.803 518.204
52                      VFDEFK   373  378  0  784.388  392.697 262.134
53                 PLVEEPQNLIK   379  389  0 1279.726  640.366 427.247
54               QNCELFEQLGEYK   390  402  0 1657.753  829.380 553.256
55                    FQNALLVR   403  410  0  960.563  480.785 320.859
56                         YTK   411  413  0  411.224  206.116 137.746
57                           K   414  414  0  147.113   74.060  49.709
58              VPQVSTPTLVEVSR   415  428  0 1511.843  756.425 504.619
59                        NLGK   429  432  0  431.261  216.134 144.425
60                        VGSK   433  436  0  390.235  195.621 130.750
61                         CCK   437  439  0  467.174  234.091 156.396
62                       HPEAK   440  444  0  581.304  291.156 194.440
63                           R   445  445  0  175.119   88.063  59.045
64       MPCAEDYLSVVLNQLCVLHEK   446  466  0 2518.214 1259.611 840.076
65                      TPVSDR   467  472  0  674.347  337.677 225.454
66                         VTK   473  475  0  347.229  174.118 116.414
67                   CCTESLVNR   476  484  0 1138.498  569.753 380.171
68                           R   485  485  0  175.119   88.063  59.045
69             PCFSALEVDETYVPK   486  500  0 1754.831  877.919 585.615
70         EFNAETFTFHADICTLSEK   501  519  0 2260.023 1130.515 754.012
71                          ER   520  521  0  304.162  152.584 102.059
72                         QIK   522  524  0  388.255  194.631 130.090
73                           K   525  525  0  147.113   74.060  49.709
74                   QTALVELVK   526  534  0 1000.604  500.805 334.206
75                          HK   535  536  0  284.172  142.589  95.395
76                          PK   537  538  0  244.166  122.586  82.060
77                         ATK   539  541  0  319.198  160.102 107.071
78                        EQLK   542  545  0  517.298  259.153 173.104
79                AVMDDFAAFVEK   546  557  0 1342.635  671.821 448.216
80                         CCK   558  560  0  467.174  234.091 156.396
81                        ADDK   561  564  0  448.204  224.606 150.073
82                   ETCFAEEGK   565  573  0 1070.446  535.727 357.487
83                           K   574  574  0  147.113   74.060  49.709
84                 LVAASQAALGL   575  585  0 1013.599  507.303 338.538
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.