rba_uniprot_uniparc_sequence: Get UniParc Entries by Sequence

In rbioapi: User-Friendly R Interface to Biologic Web Services' API

Get UniParc Entries by Sequence

Description

Retrieve UniParc Entry by providing an exact sequence. Note that partial matches will not be accepted. You can also filter the returned content of the returned UniParc entry. see "Argument" section for more details.

Usage

rba_uniprot_uniparc_sequence(
  sequence,
  rf_dd_type = NULL,
  rf_db_id = NULL,
  rf_active = NULL,
  rf_tax_id = NULL,
  ...
)

Arguments

sequence	Exact UniParc protein sequence. Partial matches will not be accepted.
rf_dd_type	Filter the content of the UniParc entry by cross-reference names. You can supply multiple values.
rf_db_id	Filter the content of the UniParc entry by protein identifiers in any cross-reference database. You can supply multiple values.
rf_active	(logical ) Filter the content of UniParc entry based on active status on source database: NULL: (default) don't filter contents based on active status. TRUE: only return contents which are still active. FALSE: Only return contents which are not active.
rf_tax_id	(Numeric) Filter the content of the UniParc entry by NIH-NCBI Taxon ID. You can supply multiple values.
...	rbioapi option(s). See rba_options's arguments manual for more information on available options.

Value

A list which correspond to a UniParc entry.

Corresponding API Resources

"POST https://ebi.ac.uk/proteins/api/uniparc/sequence"

References

• The UniProt Consortium , UniProt: the Universal Protein Knowledgebase in 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010

• Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, The Proteins API: accessing key integrated protein and genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237

• Proteins API Documentation

• Citations note on UniProt website

See Also

Other "UniProt - UniParc": rba_uniprot_uniparc(), rba_uniprot_uniparc_bestguess(), rba_uniprot_uniparc_search()

Examples

rba_uniprot_uniparc_sequence("GMRSCPRGCSQRGRCENGRCVCNPGYTGEDC")

rbioapi documentation built on April 4, 2025, 5:04 a.m.