#' Search UniParc Entries
#'
#' Use this function to search
#' \href{https://www.uniprot.org/help/uniparc}{UniProt Archive (UniParc)}
#' entries.You may also refine your search with modifiers such as sequence
#' length, taxon id etc. See "Arguments section" for more information.
#'
#' Note that this is a search function. Thus, you are not required to fill
#' every argument; You may use whatever combinations of arguments you see
#' fit for your query.
#'
#' @section Corresponding API Resources:
#' "GET https://ebi.ac.uk/proteins/api/uniparc"
#'
#' @param upi unique UniParc Identifier(s). You can supply up to 100 IDs.
#' @param accession \href{https://www.uniprot.org/help/accession_numbers}{
#' UniProtKB primary or secondary accession}(s). You can supply up to 100
#' accession numbers.
#' @param db_type \href{https://www.uniprot.org/database/}{cross-reference}
#' (external database) name.
#' @param db_id Protein ID in the cross-reference (external) database.
#' You can supply up to 100 IDs.
#' @param gene \href{https://www.uniprot.org/help/gene_name}{UniProt gene
#' name(s)}. You can supply up to 20 gene names.
#' @param protein \href{https://www.uniprot.org/help/protein_names}{UniProt
#' protein name}.
#' @param taxid NIH-NCBI \href{https://www.uniprot.org/taxonomy/}{Taxon ID}.
#' You can supply up to 20 taxon IDs.
#' @param organism \href{https://www.uniprot.org/taxonomy/}{Organism name}.
#' @param sequence_checksum Sequence CRC64 checksum.
#' @param ipr \href{https://www.ebi.ac.uk/interpro/about/interpro/}{InterPro
#' identifier(s)}. You can supply up to 20 IDs.
#' @param signature_db InterPro's
#' \href{https://interpro-documentation.readthedocs.io/en/latest/databases.html}{signature
#' database}. You can supply up to 13 of the following values:
#' \cr "CATH", "CDD", "HAMAP", "MobiDB Lite", "Panther", "Pfam", "PIRSF",
#' "PRINTS", "Prosite", "SFLD", "SMART", "SUPERFAMILY" and/or "TIGRfams"
#' @param signature_id Signature ID in the InterPro's
#' \href{https://interpro-documentation.readthedocs.io/en/latest/databases.html}{signature
#' database}. You can supply up to 20 IDs.
#' @param upid \href{https://www.uniprot.org/help/proteome_id}{UniProt Proteome
#' identifier (UPID)}. You can supply up to 100 UPIDs.
#' @param seq_length An exact sequence length (e.g. 150) or a range of sequence
#' lengths (e.g. "130-158").
#' @param rf_dd_type Filter the content of the each UniParc entry by
#' \href{https://www.uniprot.org/database/}{cross-reference} names. You can
#' supply multiple values.
#' @param rf_db_id Filter the content of the each UniParc entry by protein
#' identifiers in any cross-reference database. You can supply multiple
#' values.
#' @param rf_active (logical ) Filter the content of each UniParc entry based on
#' active status on source database:\itemize{
#' \item NULL: (default) don't filter contents based on active status.
#' \item TRUE: only return contents which are still active.
#' \item FALSE: Only return contents which are not active.}
#' @param rf_tax_id (Numeric) Filter the content of each UniParc entry by
#' NIH-NCBI \href{https://www.uniprot.org/taxonomy/}{Taxon ID}. You can
#' supply multiple values.
#' @param ... rbioapi option(s). See \code{\link{rba_options}}'s
#' arguments manual for more information on available options.
#'
#' @return A List where each element corresponds to one UniParc entry returned
#' by your search query. The element itself is a sub-list containing sequence
#' information and reference entries.
#'
#' @references \itemize{
#' \item The UniProt Consortium , UniProt: the Universal Protein
#' Knowledgebase in 2025, Nucleic Acids Research, 2024;, gkae1010,
#' https://doi.org/10.1093/nar/gkae1010
#' \item Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas
#' Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd
#' Turner, Maria Martin, The Proteins API: accessing key integrated protein
#' and genome information, Nucleic Acids Research, Volume 45, Issue W1,
#' 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237
#' \item \href{https://www.ebi.ac.uk/proteins/api/doc/}{Proteins API
#' Documentation}
#' \item \href{https://www.uniprot.org/help/publications}{Citations note
#' on UniProt website}
#' }
#'
#' @examples
#' \donttest{
#' rba_uniprot_uniparc_search(upi = "UPI00000000C9")
#' }
#' \donttest{
#' rba_uniprot_uniparc_search(accession = "P30914")
#' }
#' \donttest{
#' rba_uniprot_uniparc_search(accession = "P30914", rf_active = TRUE)
#' }
#' \donttest{
#' rba_uniprot_uniparc_search(taxid = "694009", protein = "Nucleoprotein")
#' }
#'
#' @family "UniProt - UniParc"
#' @export
rba_uniprot_uniparc_search <- function(upi = NULL,
accession = NULL,
db_type = NULL,
db_id = NULL,
gene = NULL,
protein = NULL,
taxid = NULL,
organism = NULL,
sequence_checksum = NULL,
ipr = NULL,
signature_db = NULL,
signature_id = NULL,
upid = NULL,
seq_length = NULL,
rf_dd_type = NULL,
rf_db_id = NULL,
rf_active = NULL,
rf_tax_id = NULL,
...) {
## Load Global Options
.rba_ext_args(...)
## Check User-input Arguments
.rba_args(
cons = list(
list(arg = "upi", class = "character", max_len = 100),
list(arg = "accession", class = "character", max_len = 100),
list(arg = "db_type", class = "character"),
list(arg = "db_id", class = "character"),
list(arg = "gene", class = "character", max_len = 20),
list(arg = "protein", class = "character", len = 1),
list(arg = "taxid", class = "character", max_len = 20),
list(arg = "organism", class = "character"),
list(arg = "sequence_checksum", class = "character"),
list(arg = "ipr", class = "character", max_len = 100),
list(arg = "signature_db", class = "character", max_len = 13),
list(arg = "upid", class = "character", max_len = 100),
list(arg = "seq_length", class = "character"),
list(arg = "rf_dd_type", class = "character"),
list(arg = "rf_db_id", class = "character"),
list(arg = "rf_active", class = "logical"),
list(arg = "rf_tax_id", class = "character")
)
)
.msg(
"Searching UniParc and retrieving entries that match your supplied inputs."
)
## Build GET API Request's query
call_query <- .rba_query(
init = list("size" = "-1"),
list("upi", !is.null(upi), paste0(upi, collapse = ",")),
list("accession", !is.null(accession), paste0(accession, collapse = ",")),
list("dbtype", !is.null(db_type), db_type),
list("dbid", !is.null(db_id), paste0(db_id, collapse = ",")),
list("gene", !is.null(gene), paste0(gene, collapse = ",")),
list("protein", !is.null(protein), protein),
list("taxid", !is.null(taxid), paste0(taxid, collapse = ",")),
list("organism", !is.null(organism), organism),
list("sequencechecksum", !is.null(sequence_checksum), sequence_checksum),
list("ipr", !is.null(ipr), paste0(ipr, collapse = ",")),
list("signaturetype", !is.null(signature_db), paste0(signature_db, collapse = ",")),
list("signatureid", !is.null(signature_id), paste0(signature_id, collapse = ",")),
list("upid", !is.null(upid), paste0(upid, collapse = ",")),
list("seqLength", !is.null(seq_length), seq_length),
list("rfDdtype", !is.null(rf_dd_type), paste0(rf_dd_type, collapse = ",")),
list("rfDbid", !is.null(rf_db_id), paste0(rf_db_id, collapse = ",")),
list("rfActive", !is.null(rf_active), ifelse(rf_active, "true", "false")),
list("rfTaxId", !is.null(rf_tax_id), paste0(rf_tax_id, collapse = ","))
)
## Build Function-Specific Call
parser_input <- list("json->list", .rba_uniprot_search_namer)
input_call <- .rba_httr(
httr = "get",
url = .rba_stg("uniprot", "url"),
path = paste0(.rba_stg("uniprot", "pth"), "uniparc"),
query = call_query,
accept = "application/json",
parser = parser_input,
save_to = .rba_file("uniprot_uniparc_search.json")
)
## Call API
final_output <- .rba_skeleton(input_call)
return(final_output)
}
#' Get UniParc entry
#'
#' Use this function to retrieve UniParc entries. You can use either -and only
#' one of- UniProt accession, Cross-reference database id, UniParc ID or
#' UniProt Proteome UPID. You can also filter the returned content of
#' the returned UniParc entry. see "Argument" section for more details.
#'
#' @section Corresponding API Resources:
#' "GET https://ebi.ac.uk/proteins/api/uniparc/accession/\{accession\} "
#' \cr "GET https://ebi.ac.uk/proteins/api/uniparc/dbreference/\{dbid\}"
#' \cr "GET https://ebi.ac.uk/proteins/api/uniparc/proteome/\{upid\}"
#' \cr "GET https://ebi.ac.uk/proteins/api/uniparc/upi/\{upi\}"
#'
#' @param upi unique UniParc Identifier.
#' @param accession \href{https://www.uniprot.org/help/accession_numbers}{
#' UniProtKB primary or secondary accession}.
#' @param db_id Protein ID in the cross-reference (external) database.
#' @param upid \href{https://www.uniprot.org/help/proteome_id}{UniProt Proteome
#' identifier (UPID)}. You can supply up to 100 UPIDs.
#' @param rf_dd_type Filter the content of the UniParc entry by
#' \href{https://www.uniprot.org/database/}{cross-reference} names. You can
#' supply multiple values.
#' @param rf_db_id Filter the content of the UniParc entry by protein
#' identifiers in any cross-reference database. You can supply multiple
#' values.
#' @param rf_active (logical ) Filter the content of UniParc entry based on
#' active status on source database:\itemize{
#' \item NULL: (default) don't filter contents based on active status.
#' \item TRUE: only return contents which are still active.
#' \item FALSE: Only return contents which are not active.}
#' @param rf_tax_id (Numeric) Filter the content of the UniParc entry by
#' NIH-NCBI \href{https://www.uniprot.org/taxonomy/}{Taxon ID}. You can
#' supply multiple values.
#' @param ... rbioapi option(s). See \code{\link{rba_options}}'s
#' arguments manual for more information on available options.
#'
#' @return A list which correspond to a UniParc entry.
#'
#' @references \itemize{
#' \item The UniProt Consortium , UniProt: the Universal Protein
#' Knowledgebase in 2025, Nucleic Acids Research, 2024;, gkae1010,
#' https://doi.org/10.1093/nar/gkae1010
#' \item Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas
#' Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd
#' Turner, Maria Martin, The Proteins API: accessing key integrated protein
#' and genome information, Nucleic Acids Research, Volume 45, Issue W1,
#' 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237
#' \item \href{https://www.ebi.ac.uk/proteins/api/doc/}{Proteins API
#' Documentation}
#' \item \href{https://www.uniprot.org/help/publications}{Citations note
#' on UniProt website}
#' }
#'
#' @examples
#' \donttest{
#' rba_uniprot_uniparc(upi = "UPI00000000C9")
#' }
#' \donttest{
#' rba_uniprot_uniparc(upi = "UPI00000000C9")
#' }
#' \donttest{
#' rba_uniprot_uniparc(upi = "UPI00000000C9", rf_active = FALSE)
#' }
#'
#' @family "UniProt - UniParc"
#' @export
rba_uniprot_uniparc <- function(upi = NULL,
accession = NULL,
db_id = NULL,
upid = NULL,
rf_dd_type = NULL,
rf_db_id = NULL,
rf_active = NULL,
rf_tax_id = NULL,
...) {
## Load Global Options
.rba_ext_args(...)
## Check User-input Arguments
.rba_args(
cons = list(
list(arg = "accession", class = "character"),
list(arg = "db_id", class = "character"),
list(arg = "upid", class = "character"),
list(arg = "upi", class = "character"),
list(arg = "rf_dd_type", class = "character"),
list(arg = "rf_db_id", class = "character"),
list(arg = "rf_active", class = "logical"),
list(arg = "rf_tax_id", class = "character")
),
cond = list(
list(
quote(sum(!is.null(accession), !is.null(db_id), !is.null(upid), !is.null(upi)) != 1),
"Please supply -only- one of the arguments 'accession', 'db_id', 'upid' or 'upi'."
)
)
)
.msg(
"Retriving UniParc entry with %s.",
if (!is.null(accession)) {paste0("UniProt accession ", accession)
} else if (!is.null(db_id)) {
path_input <- paste0("cross-reference database ID ", accession)
} else if (!is.null(upid)) {
path_input <- paste0("UniProt Proteome ID ", accession)
} else if (!is.null(upi)) {
path_input <- paste0("UniParc ID ", accession)
}
)
## Build GET API Request's query
call_query <- .rba_query(
init = list("size" = "-1"),
list("rfDdtype", !is.null(rf_dd_type), paste0(rf_dd_type, collapse = ",")),
list("rfDbid", !is.null(rf_db_id), paste0(rf_db_id, collapse = ",")),
list("rfActive", !is.null(rf_active), ifelse(rf_active, "true", "false")),
list("rfTaxId", !is.null(rf_tax_id), paste0(rf_tax_id, collapse = ","))
)
## Build Function-Specific Call
if (!is.null(accession)) {
path_input <- paste0(.rba_stg("uniprot", "pth"), "uniparc/accession/", accession)
} else if (!is.null(db_id)) {
path_input <- paste0(.rba_stg("uniprot", "pth"), "uniparc/dbreference/", db_id)
} else if (!is.null(upid)) {
path_input <- paste0(.rba_stg("uniprot", "pth"),"uniparc/proteome/", upid)
} else if (!is.null(upi)) {
path_input <- paste0(.rba_stg("uniprot", "pth"), "uniparc/upi/", upi)
}
input_call <- .rba_httr(
httr = "get",
url = .rba_stg("uniprot", "url"),
path = path_input,
query = call_query,
accept = "application/json",
parser = "json->list",
save_to = .rba_file("uniprot_uniparc.json")
)
## Call API
final_output <- .rba_skeleton(input_call)
return(final_output)
}
#' Get UniParc Longest Sequence for Entries
#'
#' This function returns the UniParc Entry with a cross-reference to the
#' longest active UniProtKB sequence (preferably from Swiss-Prot and if not
#' then TrEMBL). If it finds more than one longest active UniProtKB sequence
#' it returns 400 (Bad Request) error response with the list of cross
#' references found.
#'
#' @section Corresponding API Resources:
#' "GET https://ebi.ac.uk/proteins/api/uniparc/bestguess"
#'
#' @param upi unique UniParc Identifier.
#' @param accession \href{https://www.uniprot.org/help/accession_numbers}{
#' UniProtKB primary or secondary accession}(s). You can supply up to 100
#' accession numbers.
#' @param db_id Protein ID in the cross-reference (external) database.
#' You can supply up to 100 IDs.
#' @param gene \href{https://www.uniprot.org/help/gene_name}{UniProt gene
#' name(s)}. You can supply up to 20 gene names.
#' @param taxid NIH-NCBI \href{https://www.uniprot.org/taxonomy/}{Taxon ID}.
#' You can supply up to 20 taxon IDs.
#' @param ... rbioapi option(s). See \code{\link{rba_options}}'s
#' arguments manual for more information on available options.
#'
#' @return A list where each element correspond to a UniParc entry.
#'
#' @references \itemize{
#' \item The UniProt Consortium , UniProt: the Universal Protein
#' Knowledgebase in 2025, Nucleic Acids Research, 2024;, gkae1010,
#' https://doi.org/10.1093/nar/gkae1010
#' \item Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas
#' Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd
#' Turner, Maria Martin, The Proteins API: accessing key integrated protein
#' and genome information, Nucleic Acids Research, Volume 45, Issue W1,
#' 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237
#' \item \href{https://www.ebi.ac.uk/proteins/api/doc/}{Proteins API
#' Documentation}
#' \item \href{https://www.uniprot.org/help/publications}{Citations note
#' on UniProt website}
#' }
#'
#' @examples
#' \donttest{
#' rba_uniprot_uniparc_bestguess("UPI00000000C9")
#' }
#'
#' @family "UniProt - UniParc"
#' @export
rba_uniprot_uniparc_bestguess <- function(upi = NULL,
accession = NULL,
db_id = NULL,
gene = NULL,
taxid = NULL,
...) {
## Load Global Options
.rba_ext_args(...)
## Check User-input Arguments
.rba_args(
cons = list(
list(arg = "upi", class = "character", max_len = 100),
list(arg = "accession", class = "character", max_len = 100),
list(arg = "db_id", class = "character"),
list(arg = "gene", class = "character", max_len = 20),
list(arg = "taxid", class = "character", max_len = 20)
)
)
.msg(
"Retrieving UniParc longest Sequence."
)
## Build GET API Request's query
call_query <- .rba_query(
init = list("size" = "-1"),
list("upi", !is.null(upi), paste0(upi, collapse = ",")),
list("accession", !is.null(accession), paste0(accession, collapse = ",")),
list("dbid", !is.null(db_id), paste0(db_id, collapse = ",")),
list("gene", !is.null(gene), paste0(gene, collapse = ",")),
list("taxid", !is.null(taxid), paste0(taxid, collapse = ","))
)
## Build Function-Specific Call
input_call <- .rba_httr(
httr = "get",
url = .rba_stg("uniprot", "url"),
path = paste0(.rba_stg("uniprot", "pth"), "uniparc/bestguess"),
query = call_query,
accept = "application/json",
parser = "json->list",
save_to = .rba_file("uniprot_uniparc_bestguess.json")
)
## Call API
final_output <- .rba_skeleton(input_call)
return(final_output)
}
#' Get UniParc Entries by Sequence
#'
#' Retrieve UniParc Entry by providing an exact sequence. Note that partial
#' matches will not be accepted. You can also filter the returned content of
#' the returned UniParc entry. see "Argument" section for more details.
#'
#' @section Corresponding API Resources:
#' "POST https://ebi.ac.uk/proteins/api/uniparc/sequence"
#'
#' @param sequence Exact UniParc protein sequence. Partial matches will not be
#' accepted.
#' @param rf_dd_type Filter the content of the UniParc entry by
#' \href{https://www.uniprot.org/database/}{cross-reference} names. You can
#' supply multiple values.
#' @param rf_db_id Filter the content of the UniParc entry by protein
#' identifiers in any cross-reference database. You can supply multiple
#' values.
#' @param rf_active (logical ) Filter the content of UniParc entry based on
#' active status on source database:\itemize{
#' \item NULL: (default) don't filter contents based on active status.
#' \item TRUE: only return contents which are still active.
#' \item FALSE: Only return contents which are not active.}
#' @param rf_tax_id (Numeric) Filter the content of the UniParc entry by
#' NIH-NCBI \href{https://www.uniprot.org/taxonomy/}{Taxon ID}. You can
#' supply multiple values.
#' @param ... rbioapi option(s). See \code{\link{rba_options}}'s
#' arguments manual for more information on available options.
#'
#' @return A list which correspond to a UniParc entry.
#'
#' @references \itemize{
#' \item The UniProt Consortium , UniProt: the Universal Protein
#' Knowledgebase in 2025, Nucleic Acids Research, 2024;, gkae1010,
#' https://doi.org/10.1093/nar/gkae1010
#' \item Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas
#' Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd
#' Turner, Maria Martin, The Proteins API: accessing key integrated protein
#' and genome information, Nucleic Acids Research, Volume 45, Issue W1,
#' 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237
#' \item \href{https://www.ebi.ac.uk/proteins/api/doc/}{Proteins API
#' Documentation}
#' \item \href{https://www.uniprot.org/help/publications}{Citations note
#' on UniProt website}
#' }
#'
#' @examples
#' \donttest{
#' rba_uniprot_uniparc_sequence("GMRSCPRGCSQRGRCENGRCVCNPGYTGEDC")
#' }
#'
#' @family "UniProt - UniParc"
#' @export
rba_uniprot_uniparc_sequence <- function(sequence,
rf_dd_type = NULL,
rf_db_id = NULL,
rf_active = NULL,
rf_tax_id = NULL,
...) {
## Load Global Options
.rba_ext_args(...)
## Check User-input Arguments
.rba_args(
cons = list(
list(arg = "rf_dd_type", class = "character"),
list(arg = "rf_db_id", class = "character"),
list(arg = "rf_active", class = "logical"),
list(arg = "rf_tax_id", class = "character")
)
)
.msg(
"Retrieving UniParc entry that corresspond to your procided sequence."
)
## Build GET API Request's query
call_query <- .rba_query(
init = list(),
list("rfDdtype", !is.null(rf_dd_type), paste0(rf_dd_type, collapse = ",")),
list("rfDbid", !is.null(rf_db_id), paste0(rf_db_id, collapse = ",")),
list("rfActive", !is.null(rf_active), ifelse(rf_active, "true", "false")),
list("rfTaxId", !is.null(rf_tax_id), paste0(rf_tax_id, collapse = ","))
)
## Build Function-Specific Call
input_call <- .rba_httr(
httr = "post",
url = .rba_stg("uniprot", "url"),
path = paste0(.rba_stg("uniprot", "pth"), "uniparc/sequence"),
query = call_query,
body = sequence,
accept = "application/json",
httr::content_type("text/plain"),
parser = "json->list",
save_to = .rba_file("uniprot_uniparc_sequence.json")
)
## Call API
final_output <- .rba_skeleton(input_call)
return(final_output)
}
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.