aa.comp: Amino Acid Composition

Description Usage Arguments Value Author(s) See Also Examples

View source: R/aa.R

Description

Returns a table with the amino acid composition of the target protein.

Usage

1
aa.comp(target, uniprot = TRUE)

Arguments

target

a character string specifying the UniProt ID of the protein of interest or, alternatively, the sequence of that protein.

uniprot

logical, if TRUE the argument 'target' should be an ID.

Value

Returns a dataframe with the absolute frequency of each type of residue found in the target peptide.

Author(s)

Juan Carlos Aledo

See Also

is.at(), renum.pdb(), renum.meto(), renum(), aa.at()

Examples

1
aa.comp('MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQK', uniprot = FALSE)

ptm documentation built on May 24, 2021, 9:06 a.m.

Related to aa.comp in ptm...