| aa.comp | R Documentation |
Returns a table with the amino acid composition of the target protein.
aa.comp(target, uniprot = TRUE, reference = 'human', init = FALSE)
target |
a character string specifying the UniProt ID of the protein of interest or, alternatively, the sequence of that protein. |
uniprot |
logical, if TRUE the argument 'target' should be an ID. |
reference |
amino acid frequencies (in percent) of the proteinogenic amino acids to be used as reference. It should be either 'human', 'up' (composition of proteins in UniProt in 2019). Alternatively, the user can pass as argument any vector with 20 values to be used as reference. |
init |
logical, whether remove or not the first residue (initiation methionine) from the sequence. |
Returns a list where the first element is a dataframe with the observed and expected frequencies for each amino acid, the second element is the result of the Chi-squared test. In addition, a plot to reflect potential deviations from the reference standard composition is shown.
Juan Carlos Aledo
is.at(), renum.pdb(), renum.meto(), renum(), aa.at()
aa.comp('MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQK', uniprot = FALSE)
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.