aa.comp: Amino Acid Composition

In ptm: Analyses of Protein Post-Translational Modifications

Amino Acid Composition

Description

Returns a table with the amino acid composition of the target protein.

Usage

aa.comp(target, uniprot = TRUE, reference = 'human', init = FALSE)

Arguments

target	a character string specifying the UniProt ID of the protein of interest or, alternatively, the sequence of that protein.
uniprot	logical, if TRUE the argument 'target' should be an ID.
reference	amino acid frequencies (in percent) of the proteinogenic amino acids to be used as reference. It should be either 'human', 'up' (composition of proteins in UniProt in 2019). Alternatively, the user can pass as argument any vector with 20 values to be used as reference.
init	logical, whether remove or not the first residue (initiation methionine) from the sequence.

Value

Returns a list where the first element is a dataframe with the observed and expected frequencies for each amino acid, the second element is the result of the Chi-squared test. In addition, a plot to reflect potential deviations from the reference standard composition is shown.

Author(s)

Juan Carlos Aledo

See Also

is.at(), renum.pdb(), renum.meto(), renum(), aa.at()

Examples

aa.comp('MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQK', uniprot = FALSE)

ptm documentation built on Aug. 7, 2022, 5:05 p.m.