#' One-hot encoder
#'
#' `encode_one_hot` one-hot-encodes sequence in a string format.
#'
#' @param sequence Sequence in a string format.
#' @param max_length Maximum length of sequence to encode.
#'
#' @return One-hot encoded sequence.
#' @export
#'
#' @examples
#'sample_seq <- "MSHMTFNTWKAGLWRLAAAAVLSLLPVVARAAVPGITGPTFDLTAQPGRANQPDGASVYSWGYGCNPRTVPGFLPSVNPLAGQ"
#'encoded_seq <- encode_one_hot(sample_seq)
encode_one_hot <- function(sequence, max_length = 4034) {
keys <- as.list(1:20)
names(keys) <- c(
"R", "K", "D", "E", "Q", "N", "H", "S", "T", "Y",
"C", "W", "A", "I", "L", "M", "F", "V", "P", "G"
)
# Split the amino acid letter in the sequence
sequence <- sequence %>%
# Cut or pad sequence
substr(1, max_length) %>%
sprintf(paste0("%-", max_length, "s"), .) %>%
# Capitalize and split
toupper() %>%
strsplit("") %>%
unlist()
encoded_sequence <- matrix(
0,
nrow = max_length,
ncol = length(keys)
)
count <- 1
for (letter in sequence) {
encoded_sequence[count, keys[[letter]]] <- 1
count <- count + 1
}
return(encoded_sequence)
}
#' Integer encoder
#'
#' `encode_integer` integer-encodes sequence in a string format.
#'
#' @param sequence Sequence in a string format.
#' @param max_length Maximum length of sequence to encode.
#'
#' @return Integer encoded sequence.
#' @export
#'
#' @examples
#'sample_seq <- "MSHMTFNTWKAGLWRLAAAAVLSLLPVVARAAVPGITGPTFDLTAQPGRANQPDGASVYSWGYGCNPRTVPGFLPSVNPLAGQ"
#'encoded_seq <- encode_integer(sample_seq)
encode_integer <- function(sequence, max_length = 4034) {
# Define the list of the letters
keys <- as.list(0:26)
names(keys) <- c(
" ", "A", "C", "D", "E", "F", "G", "H", "I",
"K", "L", "M", "N", "P", "Q", "R", "S",
"T", "V", "W", "Y", "X", "B", "U", "J",
"Z", "O"
)
# Split the amino acid letter in the sequence
sequence <- sequence %>%
# Capitalize
toupper() %>%
# Remove non-letter chars
gsub("[^A-Z]", "", .) %>%
# Cut or pad sequence
substr(1, max_length) %>%
sprintf(paste0("%-", max_length, "s"), .) %>%
# Split
strsplit("") %>%
unlist()
# Initialize the array of zeros
encoded_sequence <- matrix(
0,
nrow = 1,
ncol = max_length
)
index <- 1
for (amino_acid in sequence) {
encoded_sequence[1, index] <- keys[[amino_acid]]
index <- index + 1
}
return(encoded_sequence)
}
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.