Description Usage Arguments Value Examples
View source: R/run_tmhmm_on_sequence.R
Run TMHMM directy on one protein sequence
1 2 3 4 | run_tmhmm_on_sequence(
protein_sequence,
folder_name = get_default_tmhmm_folder()
)
|
protein_sequence |
a protein sequence, with the amino acids as capitals, for example 'MEILCEDNTSLSSIPNSL' |
folder_name |
superfolder of TMHMM.
The superfolder's name is |
the topology. The topology is a character string
with the same length as the
protein sequence. The topology consists of the characters
i ('inside'), I ('inside'),
m ('membrane'), M ('membrane'),
o ('outside') and O ('outside')
1 2 3 4 5 6 7 | if (is_tmhmm_installed()) {
protein_sequence <- paste0(
"QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
"SLAIADMLLGFLVMPVSMLTILYGYRWP"
)
run_tmhmm_on_sequence(protein_sequence)
}
|
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.