run_tmhmm_on_sequence: Run TMHMM directy on a protein sequence
In tmhmm: Interface to TMHMM

Description Usage Arguments Value Examples

Run TMHMM directy on one protein sequence

run_tmhmm_on_sequence(
  protein_sequence,
  folder_name = get_default_tmhmm_folder()
)

`protein_sequence`	a protein sequence, with the amino acids as capitals, for example 'MEILCEDNTSLSSIPNSL'
`folder_name`	superfolder of TMHMM. The superfolder's name is `/home/[user_name]/.local/share` by default, as can be obtained by get_default_tmhmm_folder

the topology. The topology is a character string with the same length as the protein sequence. The topology consists of the characters i ('inside'), I ('inside'), m ('membrane'), M ('membrane'), o ('outside') and O ('outside')

if (is_tmhmm_installed()) {
  protein_sequence <- paste0(
    "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
    "SLAIADMLLGFLVMPVSMLTILYGYRWP"
  )
  run_tmhmm_on_sequence(protein_sequence)
}