Nothing
#' Run TMHMM directy on a protein sequence
#'
#' Run TMHMM directy on one protein sequence
#' @inheritParams default_params_doc
#' @param protein_sequence a protein sequence, with
#' the amino acids as capitals, for
#' example `MEILCEDNTSLSSIPNSL`
#' @return the topology. The topology is a character string
#' with the same length as the
#' protein sequence. The topology consists of the characters
#' \code{i} ('inside'), \code{I} ('inside'),
#' \code{m} ('membrane'), \code{M} ('membrane'),
#' \code{o} ('outside') and \code{O} ('outside')
#' @examples
#' if (is_tmhmm_installed()) {
#' protein_sequence <- paste0(
#' "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
#' "SLAIADMLLGFLVMPVSMLTILYGYRWP"
#' )
#' run_tmhmm_on_sequence(protein_sequence)
#' }
#' @export
run_tmhmm_on_sequence <- function(
protein_sequence,
folder_name = get_default_tmhmm_folder()
) {
if (length(protein_sequence) != 1) {
stop(
"'protein_sequence' must be one sequence. \n",
"Actual length: ", length(protein_sequence)
)
}
if (!is.character(protein_sequence)) {
stop(
"'protein_sequence' must be one character sequence. \n",
"Actual type: ", class(protein_sequence)
)
}
if (nchar(protein_sequence) == 0) {
stop("'protein_sequence' must have at least one character")
}
tmhmm::check_tmhmm_installation()
fasta_filename <- tempfile()
text <- c(">temp", protein_sequence)
writeLines(text, con = fasta_filename)
multi_line_topology <- tmhmm::run_tmhmm(
fasta_filename = fasta_filename,
folder_name = folder_name
)[-1]
paste0(multi_line_topology, collapse = "")
}
Any scripts or data that you put into this service are public.
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.