extractFasta: This function extract the sequences of a specific genome from...
In giangnguyen0709/fCAT: fCAT

Description Usage Arguments Value Examples

This function extract the sequences of a specific genome from a mulitple fasta file

1	extractFasta(lines, genome)

`lines`	a vector that contains lines of an extended.fasta file
`genome`	the name of the genome, that should be extracted

the vector, which contains the sequences of the interested genome

## Create pseudo extended fasta file
fasta <- c(
    ">1001705at2759|HUMAN@9606@3|Q15291|1",
    "MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGT",
    ">1489230at2759|ARATH@3702@2|3702_0:005bc2|1",
    "MAGRATIPARNSALIAMIADEDTVVGFLMAGVGNVDIRRKTNYLIVDS"
)
## Extract extended fasta of HUMAN@96063
newFasta <- extractFasta(fasta, "HUMAN@9606@3")
print(newFasta)