Nothing
#' Short protein sequence
#'
#' A short protein sequence of 31 amino acids corresponding to Q09FU3.fasta query in UniProt Data base.
#'
#' @format A character string with 31 characters "MLTITSYFGFLLAALTITSVLFIGLNKIRLI"
#' @source \url{https://www.uniprot.org/}
#' @examples
#' data(Seq31)
#' Seq31
#' nchar(Seq31)
#' data(HydroScore)
#' SeqScore=CharSequence2ScoreSequence(Seq31,HydroScore)
#' SeqScore
#' localScoreC(SeqScore)$localScore
#' LS=localScoreC(SeqScore)$localScore[1]
#' prob1 = scoreSequences2probabilityVector(list(SeqScore))
#' daudin(localScore = LS, sequence_length = nchar(Seq31),
#' score_probabilities = prob1,
#' sequence_min = min(SeqScore),
#' sequence_max = max(SeqScore))
#' score=-5:5
#' prob2=c(0.15,0.15,0.1,0.1,0.0,0.05,0.15,0.05,0.2,0.0,0.05)
#' sum(prob2*score)
#' karlin(localScore = LS, sequence_length = nchar(Seq31),
#' score_probabilities = prob2,
#' sequence_min = min(SeqScore),
#' sequence_max = max(SeqScore))
"Seq31"
#'
#' Protein sequence
#'
#' A protein sequence.
#'
#' @format A character string with 219 characters corresponding to P49755.fasta query in UniProt Data base.
#' @source \url{https://www.uniprot.org/}
#' @examples
#' data(Seq219)
#' Seq219
#' nchar(Seq219)
#' data(HydroScore)
#' seqScore=CharSequence2ScoreSequence(Seq219,HydroScore)
#' seqScore[1:30]
#' localScoreC(seqScore)$localScore
#' prob1 = scoreSequences2probabilityVector(list(seqScore))
#' daudin(localScore = 52, sequence_length = nchar(Seq219),
#' score_probabilities = prob1,
#' sequence_min = min(seqScore),
#' sequence_max = max(seqScore))
#' score=-5:5
#' prob2=c(0.15,0.15,0.1,0.1,0.0,0.05,0.15,0.05,0.2,0.0,0.05)
#' daudin(localScore = 52, sequence_length = nchar(Seq219),
#' score_probabilities = prob2,
#' sequence_min = min(seqScore),
#' sequence_max = max(seqScore))
"Seq219"
#'
#' Long protein sequence
#'
#' A long protein sequence.
#'
#' @format A character string with 1093 characters corresponding to Q60519.fasta in UniProt Data base.
#' @source \url{https://www.uniprot.org/}
#' @examples
#' data(Seq1093)
#' Seq1093
#' nchar(Seq1093)
#' data(HydroScore)
#' seqScore=CharSequence2ScoreSequence(Seq1093,HydroScore)
#' seqScore[1:50]
#' localScoreC(seqScore)$localScore
#' LS=localScoreC(seqScore)$localScore[1]
#' prob1 = scoreSequences2probabilityVector(list(seqScore))
#' daudin(localScore = LS, sequence_length = nchar(Seq1093),
#' score_probabilities = prob1,
#' sequence_min = min(seqScore),
#' sequence_max = max(seqScore))
#' karlin(localScore = LS, sequence_length = nchar(Seq1093),
#' score_probabilities = prob1,
#' sequence_min = min(seqScore),
#' sequence_max = max(seqScore))
"Seq1093"
#'
#' Dictionnaire
#'
#' Provides integer scores related to an hydrophobicity level of each amino acid. This score function is inspired by the Kyte and Doolittle (1982) scale.
#'
#' @format A score function for the 20 amino acid
#' @source Kyte & Doolittle (1982) J. Mol. Biol. 157, 105-132
#' @examples
#' data(HydroScore)
#' HydroScore
#' data(Seq219)
#' Seq219
#' seqScore=CharSequence2ScoreSequence(Seq219,HydroScore)
#' seqScore[1:30]
#' localScoreC(seqScore)$localScore
"HydroScore"
#'
#' Several sequences
#'
#' A vector of character strings
#'
#' @format A list of 285 character strings with their entry codes as names
#' @source Structural Classification Of Proteins database (SCOP). More precisely this data contain the 285 protein sequences of the data called "CF_scop2dom_20140205aa" with length from 31 to 404.
#' @examples
#' data(SeqListSCOPe)
#' head(SeqListSCOPe)
#' SeqListSCOPe[1]
#' nchar(SeqListSCOPe[1])
#' summary(sapply(SeqListSCOPe, nchar))
#' data(HydroScore)
#' MySeqScoreList=lapply(SeqListSCOPe, FUN=CharSequence2ScoreSequence, HydroScore)
#' head(MySeqScoreList)
#' AA=automatic_analysis(sequences=MySeqScoreList, model='iid')
#' AA[[1]]
#' # the p-value of the first 10 sequences
#' sapply(AA, function(x){x$`p-value`})[1:10]
#' # the 20th smallest p-values
#' sort(sapply(AA, function(x){x$`p-value`}))[1:20]
#' which(sapply(AA, function(x){x$`p-value`})<0.05)
#' table(sapply(AA, function(x){x$`method`}))
#' # The maximum sequence length equals 404 so it here normal that the exact method is used for
#' # all the 606 sequences of the data base
#' # Score distribution learnt on the data set
#' scoreSequences2probabilityVector(MySeqScoreList)
"SeqListSCOPe"
#'
#' Congenital oesophageal atresia data
#'
#' The data consists of individual dates of birth over n=35 cases of the birth defects oesophageal and tracheo-oesophagean fistula
#' observed in a hospital in Birmingham, U.K., over 2191 days from 1950 through 1955, with Day one set as 1 January 1950
#'
#' @format A matrix of 2191 lines and 2 columns. Each line is a day on the first column, and associated to a case (0/1) on the second column.
#' @source Dolk H. Secular pattern of congenital oesophageal atresia--George Knox, 1959. J Epidemiol Community Health. 1997;51(2):114-115. <doi:10.1136/jech.51.2.114>
#' @examples
#' data(Aeso)
#' head(Aeso)
#' p <- sum(Aeso[,2]) / dim(Aeso)[1]
#' print(p)
"Aeso"
#'
#' Stevens-Johnson syndrome data
#'
#' The Stevens-Johnson syndrome is an acute and serious dermatological disease due to a drug allergy.
#' The syndrome appearance is life-threatening emergency. They are very rare, around 2 cases per million people per year.
#'
#' @format A data.frame of 824 lines, each describing a syndrome appearance described by 15 covariates:
#' Case ID,
#' Initial FDA Received Date,
#' days since last fda,
#' Event Date,
#' Latest FDA Received Date,
#' Suspect Product Names,
#' Suspect Product Active Ingredients,
#' Reason for Use,
#' Reactions,
#' Serious,
#' Outcomes,
#' Sex,
#' Patient Age,
#' Sender,
#' Concomitant Product Names
#' The third column correspond to the number of days between two adverse events.
#'
#' @source FDA open data.
#' @examples
#' data(SJSyndrome.data)
#' summary(SJSyndrome.data)
"SJSyndrome.data"
#'
#' Deprecated. Use 'Aeso' instead.
#'
#'@format Deprecated. Use 'Aeso' instead.
"aeso.data"
#'
#' Deprecated. Use 'Seq31' instead.
#'
#'@format Deprecated. Use 'Seq31' instead.
"ShortSeq"
#'
#' Deprecated. Use 'Seq219' instead.
#'
#'@format Deprecated. Use 'Seq219' instead.
"MidSeq"
#'
#' Deprecated. Use 'Seq1093' instead.
#'
#'@format Deprecated. Use 'Seq1093' instead.
"LongSeq"
#'
#' Deprecated. Use 'HydroScore' instead.
#'
#'@format Deprecated. Use 'HydroScore' instead.
"dico"
#'
#' Deprecated. Use 'SeqListSCOPe' instead.
#'
#'@format Deprecated. Use 'SeqListSCOPe' instead.
"MySeqList"
Any scripts or data that you put into this service are public.
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.