makeID: make id for chain in format sp|P30443|1A01_HUMANs25

Description Usage Arguments Examples

View source: R/removeSignalPeptides.R

Description

make id for chain in format sp|P30443|1A01_HUMANs25

Usage

1
makeID(sequence, id, sp)

Arguments

sequence

- aa sequence as string

id

uniprot id id: sp|P30443|1A01_HUMAN

sp

start position of chain numeric

Examples

 1
 2
 3
 4
 5
 6
 7
 8
 9
10
11
seq <- "MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGR\
GEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRN\
MKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQ\
DAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC\
VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEI\
TLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQ\
HEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRK\
SSDRKGGSYTQAASSDSAQGSDVSLTACKV"
nam <-"sp|P30443|1A01_HUMAN"
sp <- 24
makeID(seq, nam, sp)

protViz/prozor documentation built on Oct. 26, 2018, 3:08 p.m.