is_tmh: Determine if the protein sequence contains at least one...
In pureseqtmr: Predict Transmembrane Protein Topology

Description Usage Arguments Value Author(s) Examples

Determine if the protein sequence contains at least one transmembrane helix.

1	is_tmh(protein_sequence, folder_name = get_default_pureseqtm_folder())

`protein_sequence`	a protein sequence
`folder_name`	superfolder of PureseqTM. The superfolder's name is `/home/[user_name]/.local/share` by default, as can be obtained by get_default_pureseqtm_folder

TRUE if the protein sequence contains at least one transmembrane helix

Richèl J.C. Bilderbeek

if (is_pureseqtm_installed()) {
  # This sequence is a TMH
  is_tmh("QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM")

  # This sequence is not a TMH
  is_tmh("VVIILTIRGNILVIMAVSLE")
}