is_tmh: Determine if the protein sequence contains at least one...

Description Usage Arguments Value Author(s) Examples

View source: R/is_tmh.R

Description

Determine if the protein sequence contains at least one transmembrane helix.

Usage

1
is_tmh(protein_sequence, folder_name = get_default_pureseqtm_folder())

Arguments

protein_sequence

a protein sequence

folder_name

superfolder of PureseqTM. The superfolder's name is /home/[user_name]/.local/share by default, as can be obtained by get_default_pureseqtm_folder

Value

TRUE if the protein sequence contains at least one transmembrane helix

Author(s)

Richèl J.C. Bilderbeek

Examples

1
2
3
4
5
6
7
if (is_pureseqtm_installed()) {
  # This sequence is a TMH
  is_tmh("QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM")

  # This sequence is not a TMH
  is_tmh("VVIILTIRGNILVIMAVSLE")
}

pureseqtmr documentation built on July 30, 2020, 5:13 p.m.