predict_topology_from_sequence: Run PureseqTM directy on a protein sequence

Description Usage Arguments Value Author(s) Examples

View source: R/predict_topology_from_sequence.R

Description

Run PureseqTM directy on a protein sequence

Usage

1
2
3
4
predict_topology_from_sequence(
  protein_sequence,
  folder_name = get_default_pureseqtm_folder()
)

Arguments

protein_sequence

a protein sequence, with the amino acids as capitals, for example MEILCEDNTSLSSIPNSL

folder_name

superfolder of PureseqTM. The superfolder's name is /home/[user_name]/.local/share by default, as can be obtained by get_default_pureseqtm_folder

Value

a topology as a string of zeroes and ones, where a one denotes that the corresponding amino acid is located within the membrane.

Author(s)

Richèl J.C. Bilderbeek

Examples

1
2
3
4
5
6
7
if (is_pureseqtm_installed()) {
  protein_sequence <- paste0(
    "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
    "SLAIADMLLGFLVMPVSMLTILYGYRWP"
  )
  predict_topology_from_sequence(protein_sequence)
}

pureseqtmr documentation built on July 30, 2020, 5:13 p.m.