predict_topology_from_sequence: Run PureseqTM directy on a protein sequence
In pureseqtmr: Predict Transmembrane Protein Topology

Description Usage Arguments Value Author(s) Examples

View source: R/predict_topology_from_sequence.R

Run PureseqTM directy on a protein sequence

predict_topology_from_sequence(
  protein_sequence,
  folder_name = get_default_pureseqtm_folder()
)

`protein_sequence`	a protein sequence, with the amino acids as capitals, for example `MEILCEDNTSLSSIPNSL`
`folder_name`	superfolder of PureseqTM. The superfolder's name is `/home/[user_name]/.local/share` by default, as can be obtained by get_default_pureseqtm_folder

a topology as a string of zeroes and ones, where a one denotes that the corresponding amino acid is located within the membrane.

Richèl J.C. Bilderbeek

if (is_pureseqtm_installed()) {
  protein_sequence <- paste0(
    "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
    "SLAIADMLLGFLVMPVSMLTILYGYRWP"
  )
  predict_topology_from_sequence(protein_sequence)
}