are_tmhs: Are the sequences transmembrance helices?

Description Usage Arguments Value Author(s) Examples

View source: R/are_tmhs.R

Description

Are the sequences transmembrance helices?

Usage

1
are_tmhs(protein_sequences, folder_name = get_default_pureseqtm_folder())

Arguments

protein_sequences

one or more protein sequences

folder_name

superfolder of PureseqTM. The superfolder's name is /home/[user_name]/.local/share by default, as can be obtained by get_default_pureseqtm_folder

Value

a vector of booleans of the same length as the number of sequences. The ith element is TRUE if the ith protein sequence is a transmembrane helix

Author(s)

Richèl J.C. Bilderbeek

Examples

1
2
3
4
5
6
7
if (is_pureseqtm_installed()) {
  sequences <- c(
    "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
    "VVIILTIRGNILVIMAVSLE"
  )
  are_tmhs(sequences)
}

pureseqtmr documentation built on July 30, 2020, 5:13 p.m.