Nothing
#' Are the sequences transmembrance helices?
#' @inheritParams default_params_doc
#' @return a vector of booleans of the same length as the
#' number of sequences. The ith element is \link{TRUE} if
#' the ith protein sequence is a transmembrane helix
#' @examples
#' if (is_pureseqtm_installed()) {
#' sequences <- c(
#' "QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLM",
#' "VVIILTIRGNILVIMAVSLE"
#' )
#' are_tmhs(sequences)
#' }
#' @author Richèl J.C. Bilderbeek
#' @export
are_tmhs <- function(
protein_sequences,
folder_name = get_default_pureseqtm_folder()
) {
pureseqtmr::check_pureseqtm_installation(folder_name)
results <- rep(NA, length(protein_sequences))
for (i in seq_along(protein_sequences)) {
results[i] <- pureseqtmr::is_tmh(protein_sequences[i])
}
results
}
Any scripts or data that you put into this service are public.
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.